
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Felis catus (Cat) (Felis silvestris catus)
Uniprot NO.:Q6V915
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLSQLGLWLRRLWVLFQVALQVAVGKVFLILFPSRVKQHIVAMNRKNPHFSYDNWAPTL YSVQYFWFVLKVRWQRLEDRTEPGGLAPNCPVVRLSGQRCSIWDFMKGNRPLVLNFGSCT UPSFLFKFDQFKRLIEDFCSIADFLIIYIEEAHASDGWAFKNNVNIRNHRNLQDRLQAAC LLLDRSPRCPVVVDTMKNQSSRLYAALPERLYVLQAGRILYKGKPGPWNYHPEEVRAVLE KLHS
Protein Names:Recommended name: Type I iodothyronine deiodinase EC= 1.97.1.10 Alternative name(s): 5DI DIOI Type 1 DI Type-I 5'-deiodinase
Gene Names:Name:DIO1
Expression Region:1-244
Sequence Info:full length protein
You may also like
-
Recombinant Mouse Type I iodothyronine deiodinase(Dio1)
- Regular price
- ¥184,700 JPY
- Sale price
- ¥184,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Type I iodothyronine deiodinase(DIO1)
- Regular price
- ¥183,700 JPY
- Sale price
- ¥183,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Type I iodothyronine deiodinase(Dio1)
- Regular price
- ¥184,700 JPY
- Sale price
- ¥184,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Type I iodothyronine deiodinase(DIO1)
- Regular price
- ¥183,700 JPY
- Sale price
- ¥183,700 JPY
- Regular price
-
- Unit price
- per
Sold out