Gene Bio Systems
Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B
Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B
SKU:CSB-EP330956CEC
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Carpinus betulus (European hornbeam) (Carpinus caucasica)
Delivery time: 3-7 business days
Uniprot ID: P38949
AA Sequence: GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN
Tag info: N-terminal 6xHis-tagged
Expression Region: 2-160aa
Protein length: Full Length
MW: 21.3 kDa
Alternative Name(s):
Relevance:
Reference: PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam.Nedergaard Larsen J., Stroeman P., Ipsen H.Mol. Immunol. 29:703-711(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.