Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM14(PAM18)

Recombinant Candida albicans Mitochondrial import inner membrane translocase subunit TIM14(PAM18)

SKU:CSB-CF701592CZD

Regular price ¥268,400 JPY
Regular price Sale price ¥268,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Uniprot NO.:Q59SI2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPLEAPILAIPGENNTHQQQQQQFQYTGQLQKKKAAEGSIEWYFDQTINFMGDHPVITG IGAFAVAYFAAGFIKSNQPGINGKAFVKGGFGAKMTAKEALQILNLKETNLSKLKLKEQH RKLMMANHPDKGGSSYIATKINEAKDFLDKRGGMKPK

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s): Presequence translocated-associated motor subunit PAM18

Gene Names:Name:PAM18 Synonyms:TIM14 ORF Names:CaO19.11667, CaO19.4190

Expression Region:1-157

Sequence Info:full length protein

View full details