Gene Bio Systems
Recombinant Candida albicans Golgi to ER traffic protein 1(GET1)
Recombinant Candida albicans Golgi to ER traffic protein 1(GET1)
SKU:CSB-CF685485CZD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Uniprot NO.:Q5ACW6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLLPDLHPYTILLSIFLVLVAKQLVATIGKSTIQEFVWLVYLKVSSNQSIKTYNSKQHEL HETNRQKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQKSSIDKASNALILVLTT LPIWIARVFYRKTHLFYIRQGIFPKYVEWVLALPFLPNGAVGLTIWMFAVNSVVSNFSFL VSFPFAKRVSKPVRDTKVE
Protein Names:Recommended name: Golgi to ER traffic protein 1 Alternative name(s): Guided entry of tail-anchored proteins 1
Gene Names:Name:GET1 ORF Names:CaO19.2101, CaO19.9649
Expression Region:1-199
Sequence Info:full length protein
