Gene Bio Systems
Recombinant Campylobacter hominis ATP synthase subunit a(atpB)
Recombinant Campylobacter hominis ATP synthase subunit a(atpB)
SKU:CSB-CF015070CWD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A)
Uniprot NO.:A7I1B2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKDIFLFWGSLFGYDHTAIYIFHFLLVVAITMFIAVAVTKSMRLVPRGLQNIIEAYLSG VIALGKDAMGSEKLARKYMPLIATIGFIVFLSNIIGLIPGFEAPTASLNLTLSLTLCVFF YYHFEGIREKGFIKYFAGFCGPVKAIAPFMFVIEVISHLSRIISLSFRLFGNIKGDDLFL LVMLTLAPVLVPMIPYALLSFMAILQAFIFMVLSYVYLAGAVVVDEEH
Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6
Gene Names:Name:atpB Ordered Locus Names:CHAB381_0723
Expression Region:1-228
Sequence Info:full length protein
