Skip to product information
1 of 1

Gene Bio Systems

Recombinant Campylobacter fetus subsp. fetus UPF0059 membrane protein CFF8240_1725 (CFF8240_1725)

Recombinant Campylobacter fetus subsp. fetus UPF0059 membrane protein CFF8240_1725 (CFF8240_1725)

SKU:CSB-CF368245CWC

Regular price ¥274,000 JPY
Regular price Sale price ¥274,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter fetus subsp. fetus (strain 82-40)

Uniprot NO.:A0RRL1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELIFLSIALAMDSVAISMANGARCMNIKALQIFKMSFLFGIFQAFMPVIGYFLGLAFVG FISYIDHYVAFAILLFLGIKMIKESRQISVHCSLNLSLRMLMLGAFATSLDALAVGITFS FEEINIAIAAFVIGLVCFVLCVIASYMGRVLGEMLESKALVLGGVILILIGCKIIITHLI N

Protein Names:Recommended name: UPF0059 membrane protein CFF8240_1725

Gene Names:Ordered Locus Names:CFF8240_1725

Expression Region:1-181

Sequence Info:full length protein

View full details