Skip to product information
1 of 1

Gene Bio Systems

Recombinant Campylobacter curvus UPF0059 membrane protein Ccur92_01080 (Ccur92_01080)

Recombinant Campylobacter curvus UPF0059 membrane protein Ccur92_01080 (Ccur92_01080)

SKU:CSB-CF414833CWB

Regular price ¥273,700 JPY
Regular price Sale price ¥273,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter curvus (strain 525.92)

Uniprot NO.:A7GW20

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEILLLAFALAMDSVALSIASGAKCRTLSFLQVLKTALIFGVFQALMPFLGYILGLSFVN FIQEIDHFIAFGILGFLGAKMILEAHHTKDEPCLINLSSKDLALGAVATSIDALAVGITF SFANVDVTYSCLIIGTVCFVLCTAACYVGKILGAWLEAKALVLGGLILIGLGTKILITHL VDHI

Protein Names:Recommended name: UPF0059 membrane protein Ccur92_01080

Gene Names:Ordered Locus Names:Ccur92_01080 ORF Names:CCV52592_0090

Expression Region:1-184

Sequence Info:full length protein

View full details