Skip to product information
1 of 1

Gene Bio Systems

Recombinant Calycanthus floridus var. glaucus Chloroplast envelope membrane protein(cemA)

Recombinant Calycanthus floridus var. glaucus Chloroplast envelope membrane protein(cemA)

SKU:CSB-CF771974CBM

Regular price ¥284,000 JPY
Regular price Sale price ¥284,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)

Uniprot NO.:Q7YJW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKKKALTPFPYLASIVFLPWWISLSFTKSLEPWVTNWWNTGQSKTFLNDIQEKNVLERF IELEQLFLLDEMIKEYPETQIQKFHIGIHKETLQLVKMHNEDHIHIVLHFSTNIICFAIL SGYYFLGNEELVILNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSPRGWELMIGSVYKD FGFAHNDQIISGLVSTFPVILDTILKYWIFHYLNRVSPSLVVIYHSMNE

Protein Names:Recommended name: Chloroplast envelope membrane protein

Gene Names:Name:cemA

Expression Region:1-229

Sequence Info:full length protein

View full details