
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mycobacterium bovis
Uniprot NO.:P68434
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRDPVLFAIPCFLLLLILEWTAARKLESIETAATGQPRPASGAYLTRDSVASISMGLVSI ATTAGWKSLALLGYAAIYAYLAPWQLSAHRWYTWVIAIVGVDLLYYSYHRIAHRVRLIWA THQAHHSSEYFNFATALRQKWNNSGEILMWVPLPLMGLPPWMVFCSWSLNLIYQFWVHTE RIDRLPRWFEFVFNTPSHHRVHHGMDPVYLDKNYGGILIIWDRLFGSFQPELFRPHYGLT KRVDTFNIWKLQTREYVAIVRDWRSATRLRDRLGYVFGPPGWEPRTIDKSNAAASLVTSR
Protein Names:Recommended name: C-5 sterol desaturase EC= 1.3.-.- Alternative name(s): Sterol-C5-desaturase
Gene Names:Name:erg3 Ordered Locus Names:Mb1844
Expression Region:1-300
Sequence Info:full length protein
You may also like
-
Recombinant C-5 sterol desaturase(erg3)
- Regular price
- ¥190,800 JPY
- Sale price
- ¥190,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Ashbya gossypii C-5 sterol desaturase(ERG3)
- Regular price
- ¥197,000 JPY
- Sale price
- ¥197,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Candida albicans C-5 sterol desaturase(ERG3)
- Regular price
- ¥201,200 JPY
- Sale price
- ¥201,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae C-5 sterol desaturase(ERG3)
- Regular price
- ¥198,700 JPY
- Sale price
- ¥198,700 JPY
- Regular price
-
- Unit price
- per
Sold out