Gene Bio Systems
Recombinant Burkholderia xenovorans Probable intracellular septation protein A(Bxeno_A2153)
Recombinant Burkholderia xenovorans Probable intracellular septation protein A(Bxeno_A2153)
SKU:CSB-CF621754BNV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Burkholderia xenovorans (strain LB400)
Uniprot NO.:Q13YZ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFLFDLFPIILFFVAFKIWGIFTATAVAIVATLVQIAWVAFRHRKVDPMLWVSLGVVTV FGGATLVLHNDTFIKWKPTVLYWAFSVALIVSQLAFNKNLIEAMMGKQITLPHAIWGKLN VVWGVFFVLLGLVNLFVAYNYTTDQWVNFKLFGATGCLVVFIVGQSLWLSKYMKEE
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:Bxeno_A2153 ORF Names:Bxe_A2278
Expression Region:1-176
Sequence Info:full length protein
