Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia vietnamiensis Probable intracellular septation protein A (Bcep1808_1842)

Recombinant Burkholderia vietnamiensis Probable intracellular septation protein A (Bcep1808_1842)

SKU:CSB-CF391314BPV

Regular price ¥269,800 JPY
Regular price Sale price ¥269,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))

Uniprot NO.:A4JEZ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGLANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Bcep1808_1842

Expression Region:1-176

Sequence Info:full length protein

View full details