Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia thailandensis Disulfide bond formation protein B(dsbB)

Recombinant Burkholderia thailandensis Disulfide bond formation protein B(dsbB)

SKU:CSB-CF648733BAAJ

Regular price ¥270,900 JPY
Regular price Sale price ¥270,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301)

Uniprot NO.:Q2SY47

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNLTLSLHRERRLLVLLGLVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFI GAGMASGAGIAVIEALIVLSAAAGVGTAARHLYVQLNPGFSCGFDALQPVVDSLPPAHWL PGVFKVAGLCETVYPPIFGILLPGWALIAFALIVVPVAASLLRHRGRLR

Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase

Gene Names:Name:dsbB Ordered Locus Names:BTH_I1614

Expression Region:1-169

Sequence Info:full length protein

View full details