Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia sp. Probable intracellular septation protein A(Bcep18194_A5211)

Recombinant Burkholderia sp. Probable intracellular septation protein A(Bcep18194_A5211)

SKU:CSB-CF667758BAAK

Regular price ¥269,700 JPY
Regular price Sale price ¥269,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Burkholderia sp. (strain 383) (Burkholderia cepacia (strain ATCC 17760 / NCIB 9086 / R18194))

Uniprot NO.:Q39FG1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGVANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Bcep18194_A5211

Expression Region:1-176

Sequence Info:full length protein

View full details