Gene Bio Systems
Recombinant Burkholderia phymatum UPF0060 membrane protein Bphy_5052 (Bphy_5052)
Recombinant Burkholderia phymatum UPF0060 membrane protein Bphy_5052 (Bphy_5052)
SKU:CSB-CF458397BXT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia phymatum (strain DSM 17167 / STM815)
Uniprot NO.:B2JLR2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRTLLLYVVTAVAEIVGCYLPWRWLKEGGSVWLLLPGALSLALFAWLLTFHGTAAGRVYA AYGGVYVAVAILWLWCVDHVRPSAWDLAGVALTLAGMSIIAFQPRL
Protein Names:Recommended name: UPF0060 membrane protein Bphy_5052
Gene Names:Ordered Locus Names:Bphy_5052
Expression Region:1-106
Sequence Info:full length protein
