Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia mallei UPF0060 membrane protein BMA10247_0554 (BMA10247_0554)

Recombinant Burkholderia mallei UPF0060 membrane protein BMA10247_0554 (BMA10247_0554)

SKU:CSB-CF386594BPQ

Regular price ¥260,400 JPY
Regular price Sale price ¥260,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Burkholderia mallei (strain NCTC 10247)

Uniprot NO.:A3MIN7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG

Protein Names:Recommended name: UPF0060 membrane protein BMA10247_0554

Gene Names:Ordered Locus Names:BMA10247_0554

Expression Region:1-110

Sequence Info:full length protein

View full details