Gene Bio Systems
Recombinant Burkholderia cenocepacia UPF0060 membrane protein Bcen_0802(Bcen_0802)
Recombinant Burkholderia cenocepacia UPF0060 membrane protein Bcen_0802(Bcen_0802)
SKU:CSB-CF621336BAAG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia cenocepacia (strain AU 1054)
Uniprot NO.:Q1BXE3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTELMRIAALFAATALAEIVGCYLPWLVLKAGRPAWLLVPAALSLALFAWLLTLHPSAAG RTYAAYGGVYIAVALIWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA
Protein Names:Recommended name: UPF0060 membrane protein Bcen_0802
Gene Names:Ordered Locus Names:Bcen_0802
Expression Region:1-110
Sequence Info:full length protein
