Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia ambifaria Probable intracellular septation protein A(Bamb_1898)

Recombinant Burkholderia ambifaria Probable intracellular septation protein A(Bamb_1898)

SKU:CSB-CF602498BAAF

Regular price ¥270,100 JPY
Regular price Sale price ¥270,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD))

Uniprot NO.:Q0BEG9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGVANLYVVHNYTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Bamb_1898

Expression Region:1-176

Sequence Info:full length protein

View full details