Recombinant Buchnera aphidicola subsp. Schizaphis graminum  UPF0092 membrane protein BUsg_126(BUsg_126)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0092 membrane protein BUsg_126(BUsg_126)

CSB-CF815731BXE
Regular price
¥165,500 JPY
Sale price
¥165,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8KA08

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFFIKDANAAVNQALEGNSYSLIFMLVTFILIFYFMLFRPQQKKDKEHKNLMNSIAPGD EVMTTSGFLGRVKKVTENGYVLLQLNNTTEIFIKKDFIVSSLPKGTLESL

Protein Names:Recommended name: UPF0092 membrane protein BUsg_126

Gene Names:Ordered Locus Names:BUsg_126

Expression Region:1-110

Sequence Info:full length protein

Your list is ready to share