Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o ubiquinol oxidase subunit 3(cyoC)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o ubiquinol oxidase subunit 3(cyoC)

SKU:CSB-CF818375BXE

Regular price ¥275,200 JPY
Regular price Sale price ¥275,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8K995

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKETMRNNKLFGLWIYLMSDCIIFAVLFAVYAIISSNFSTNLINHKIFNLSYVFLETLI LLLSSLSSGMLTIQKNKNNIKIIYFYLLLTFFLGLSFLLMEVNEFYKLILENCSPSQHAF FSIFFTIVGVHGIHVFFGLIFILSILYQLFYLGITNTIRIRILCFSLFWHFLDIIWICVF TFVYLNGVI

Protein Names:Recommended name: Cytochrome o ubiquinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Cytochrome o ubiquinol oxidase subunit III

Gene Names:Name:cyoC Ordered Locus Names:BUsg_454

Expression Region:1-189

Sequence Info:full length protein

View full details