Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Myzus persicae Membrane protein insertase YidC(yidC)

Recombinant Buchnera aphidicola subsp. Myzus persicae Membrane protein insertase YidC(yidC)

SKU:CSB-CF523792BXD

Regular price ¥275,800 JPY
Regular price Sale price ¥275,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Myzus persicae (Myzus persicae primary endosymbiont)

Uniprot NO.:O51829

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SRTLIKSKLWVGPEIQKEMKLVAPNLDLTVDYGWLWFLSQPLFKLLTIINSIINNWGFSI ILITFIMKIITYPLTKSQYVSMSKIRALQPKIKEIKEAFSDNKQRISQEMIILYKKEKIN PLGGFLPVFIQMPVFLSLYYMLIGSVELRHAPFVLWIKDLSSQDPFYVLPIIMGLTMFFI QKTSSNNISDPIQKKIMNFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQKFIFSNFKSN

Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC

Gene Names:Name:yidC

Expression Region:1-240

Sequence Info:full length protein

View full details