Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0056 membrane protein bbp_399(bbp_399)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0056 membrane protein bbp_399(bbp_399)

SKU:CSB-CF803673BMZ

Regular price ¥277,400 JPY
Regular price Sale price ¥277,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Uniprot NO.:Q89AB7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKEIISVTILLILIMDPLGNLPIFMSILKHLEPQRRKKILIREMMIALLIMLLFLFAGEK ILIFLNLRAETVSVSGGIILFLIAIKMIFPTYESKKKSGNIIKREEPFLVPLAIPLVAGP SLLATLMLLSHQYPKKILYLIGSLLIAWMITVVILLLSDIFLRLFGSKGVNALERLMGLI LIMLSTQMFLDGIKSWFYI

Protein Names:Recommended name: UPF0056 membrane protein bbp_399

Gene Names:Ordered Locus Names:bbp_399

Expression Region:1-199

Sequence Info:full length protein

View full details