Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae High-affinity zinc uptake system membrane protein znuB(znuB)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae High-affinity zinc uptake system membrane protein znuB(znuB)

SKU:CSB-CF805074BMZ

Regular price ¥285,500 JPY
Regular price Sale price ¥285,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Uniprot NO.:Q89AJ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYKTFFFGWLAGVLLTTITGPLGLFIIWRRMSSFGDTLSHSSLLGISFAVLLNIHPFFMV IITILLFGMLIIWLNYTTVLSLDTILGIIGYSFLSLGMIIINSISNFQKNKLTNYLFGNL LEVTYIDIVILIISCVSILFVLVWYWDLMLLTTINSDLAKIDGVNVLKINSILIFLITLT IGIAIKFIGSLIAISLLIIPAATAQRFSTSPEKMAFFSVIIGIISITWGILMSVYYNLAI SPTIVFCSSIVFVISNLKKIL

Protein Names:Recommended name: High-affinity zinc uptake system membrane protein znuB

Gene Names:Name:znuB Ordered Locus Names:bbp_294

Expression Region:1-261

Sequence Info:full length protein

View full details