Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein FliQ(fliQ)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein FliQ(fliQ)

SKU:CSB-CF805715BMZ

Regular price ¥256,600 JPY
Regular price Sale price ¥256,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Uniprot NO.:Q89AZ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIESVMSLFYDAMKVTLMISLPLLLSALCCGLIVSIFQAATQINEQTLSFIPKIAAVLV SIVIFGPWMLVILSDYTHTLFYNLSYITYS

Protein Names:Recommended name: Flagellar biosynthetic protein FliQ

Gene Names:Name:fliQ Ordered Locus Names:bbp_077

Expression Region:1-90

Sequence Info:full length protein

View full details