Gene Bio Systems
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Ubiquinol oxidase subunit 2(cyoA)
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Ubiquinol oxidase subunit 2(cyoA)
SKU:CSB-CF348998BWZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Uniprot NO.:P57544
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CNNPLLNSHGTIATEEYSLILISFIMMLFIIIPVIFMTIYFSLKYRSTNVNQIYKPNWCD SKKIEIVVWTIPIIIVSFLAFLSWSYTHKLDPKKSIVSLNNPIKIDAVALDWKWLFIYPD YNIATINEIMFPVNRPIVFRITSNSVMNAFFIPSLGSQIYAMPGMTTKLNLIANDVGKYK GISSNYSGHGFSNMKFTAISVLKNSTFLDWVKKVQASSIKLNTMKTFDIISIPNENYSIE YFSSVKKNLFNKIKNQYSIKHFILDENLSHEIVKKNFNMEK
Protein Names:Recommended name: Ubiquinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome o subunit 2 Cytochrome o ubiquinol oxidase subunit 2 Oxidase BO(3) subunit 2 Ubiquinol oxidase polypeptide II
Gene Names:Name:cyoA Ordered Locus Names:BU472
Expression Region:16-296
Sequence Info:full length protein
