Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella canis ATP synthase subunit b 1(atpF1)

Recombinant Brucella canis ATP synthase subunit b 1(atpF1)

SKU:CSB-CF429413BPH

Regular price ¥240,300 JPY
Regular price Sale price ¥240,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella canis (strain ATCC 23365 / NCTC 10854)

Uniprot NO.:A9M8G0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTA TIVEQLLGLTADKASVSEAVKAIRASNA

Protein Names:Recommended name: ATP synthase subunit b 1 Alternative name(s): ATP synthase F(0) sector subunit b 1 ATPase subunit I 1 F-type ATPase subunit b 1 Short name= F-ATPase subunit b 1

Gene Names:Name:atpF1 Ordered Locus Names:BCAN_A0389

Expression Region:1-208

Sequence Info:full length protein

View full details