Recombinant Brucella abortus biovar 1  Immunogenic membrane protein YajC(yajC)

Recombinant Brucella abortus biovar 1 Immunogenic membrane protein YajC(yajC)

CSB-CF313379BWS
Regular price
¥165,700 JPY
Sale price
¥165,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella abortus biovar 1 (strain 9-941)

Uniprot NO.:P0C120

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFVTPAFAQASGSVVGPDMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRGDT VVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPVADNKNK

Protein Names:Recommended name: Immunogenic membrane protein YajC

Gene Names:Name:yajC Ordered Locus Names:BruAb1_0902

Expression Region:1-113

Sequence Info:full length protein

Your list is ready to share