Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brevibacillus brevis UPF0756 membrane protein BBR47_23170 (BBR47_23170)

Recombinant Brevibacillus brevis UPF0756 membrane protein BBR47_23170 (BBR47_23170)

SKU:CSB-CF505935BWL

Regular price ¥268,200 JPY
Regular price Sale price ¥268,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

Uniprot NO.:C0ZBY5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMSGEVMLVILIVIGLIGRSPIIATAASILLVLKLTALERFFPTVERRGLELGLLFLTIS VLVPFASEKISWKDVTPLFTTVVGLTALAGGAIATWMNGKGLDLLRSEPHMIVGLVIGSI IGIVFFRGIPVGPLMAAGITAFVLKLWEWFGSR

Protein Names:Recommended name: UPF0756 membrane protein BBR47_23170

Gene Names:Ordered Locus Names:BBR47_23170

Expression Region:1-153

Sequence Info:full length protein

View full details