Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium sp. Cbb3-type cytochrome c oxidase subunit FixP(fixP)

Recombinant Bradyrhizobium sp. Cbb3-type cytochrome c oxidase subunit FixP(fixP)

SKU:CSB-CF397443BPF

Regular price ¥293,100 JPY
Regular price Sale price ¥293,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bradyrhizobium sp. (strain ORS278)

Uniprot NO.:A4YQU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADHSEVDSVSGTATTGHAWDGIKELNTPLPRWWVITFYITIVWAIGYWIVYPAWPTITS NTKGLFGYSSRADVAVELANLEKIRGDKMAALATASLADIEKDPQMLALARAKGKTVFGD NCAACHGTGAAGAKGFPNLNDDDWLWGGSLEQIQQTLLYGVRSGHPKTREGQMLAFGKDG TLKPAEIITVANYVRSLSGLPTRQGYDAAAGAKIFAENCVACHGDNAKGNPEVGAPNLTD KIWLYGSDEATLIETITNGRAGVMPAWEGRLDPTTIKAMAVYVHSLGGGK

Protein Names:Recommended name: Cbb3-type cytochrome c oxidase subunit FixP Short name= Cbb3-Cox subunit FixP Alternative name(s): C-type cytochrome FixP Short name= Cyt c(FixP) Cytochrome c oxidase subunit III

Gene Names:Name:fixP Synonyms:ccoP Ordered Locus Names:BRADO2441

Expression Region:1-290

Sequence Info:full length protein

View full details