Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit(ATP6V0C)

Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit(ATP6V0C)

SKU:CSB-CF002389BO

Regular price ¥267,900 JPY
Regular price Sale price ¥267,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P23956

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEAKNGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit

Gene Names:Name:ATP6V0C Synonyms:ATP6C, ATP6L

Expression Region:1-155

Sequence Info:Full length protein

View full details