Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine UPF0697 protein C8orf40 homolog

Recombinant Bovine UPF0697 protein C8orf40 homolog

SKU:CSB-CF399766BO

Regular price ¥251,500 JPY
Regular price Sale price ¥251,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A5D7B5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPGGYGVMGDDGAMDYSVHEAWNEATNVYLVVILVSFGLFMYAKRNKRKIMRIFSLPPPA ETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQSQADSVQLSLE

Protein Names:Recommended name: UPF0697 protein C8orf40 homolog

Gene Names:

Expression Region:1-107

Sequence Info:full length protein

View full details