Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane protein ENSP00000343375 homolog

Recombinant Bovine Transmembrane protein ENSP00000343375 homolog

SKU:CSB-CF652897BO

Regular price ¥280,100 JPY
Regular price Sale price ¥280,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q2YDG1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATEDREMMEGRGAGESCPTFPKMAPDDPMSEGKPRASLPQEADTPKPDSSYDYLEEMET CEDGGCPGPPKVLSSKAGPATTKGQAGDGLELAELPSVPATAAPGSPVRERDAEMELEKV RMEFELKRLKYLHEENERQRQHEEVMEQLQQQATPRLFSGGLQDLLLPQNQFAMFLYCFI FIHIIYVTKEMIFFLFSKHYLFCIAAILLCLIKTLWS

Protein Names:Recommended name: Transmembrane protein ENSP00000343375 homolog

Gene Names:

Expression Region:1-217

Sequence Info:full length protein

View full details