Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane protein 47(TMEM47)

Recombinant Bovine Transmembrane protein 47(TMEM47)

SKU:CSB-CF023845BO

Regular price ¥272,400 JPY
Regular price Sale price ¥272,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q1JPA3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRK PASLDIWHCESTLSSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLF AAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDY Y

Protein Names:Recommended name: Transmembrane protein 47 Alternative name(s): Transmembrane 4 superfamily member 10

Gene Names:Name:TMEM47 Synonyms:TM4SF10

Expression Region:1-181

Sequence Info:full length protein

View full details