Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane 4 L6 family member 5(TM4SF5)

Recombinant Bovine Transmembrane 4 L6 family member 5(TM4SF5)

SKU:CSB-CF640669BO

Regular price ¥276,700 JPY
Regular price Sale price ¥276,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q2KIG8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCTGKCARFVGLSLIPLSLVCIVANALLLVPNGQTTWTKDHLSLQVWLMAGFVGGGLMVL CPGISAVRAGGKGCCGAGCCGNRCRMLRSVFCSAIGLLGAIYCLSVSGTGLRIGPQCLMN GSWDYHFQDTAGSYLLNRTQWNLCVEPPDVVLWNVTLFSLLVAASCLEILLCGVQLVNAS IGVLCGDCRKKQGSSQ

Protein Names:Recommended name: Transmembrane 4 L6 family member 5

Gene Names:Name:TM4SF5

Expression Region:1-196

Sequence Info:full length protein

View full details