Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Synapse differentiation-inducing gene protein 1-like(SYNDIG1L)

Recombinant Bovine Synapse differentiation-inducing gene protein 1-like(SYNDIG1L)

SKU:CSB-CF023895BO

Regular price ¥276,700 JPY
Regular price Sale price ¥276,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A4IFJ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESLSELQNPLLPRSPTHLHGPYPYPEASPAWPCREKIYSYLLGGAGPAHAHQLLDPGSL QLAVEAWYRPSCLLGRDKVKEPRPGSCETSFTEGREPPAGPTERSTEPGQAEEDVAIQTV SYGVQEEFQGQEGDPEEEESDATSTESESEDNFLTLPPRDHLGLTIFSMLCCFWPLGIAA FYFSQGTSKAISKGDFRLANTTSRRALFLATLSIAVGAGLYVAVVVALAAYMSQNGHS

Protein Names:Recommended name: Synapse differentiation-inducing gene protein 1-like Alternative name(s): Capucin Transmembrane protein 90A

Gene Names:Name:SYNDIG1L Synonyms:TMEM90A

Expression Region:1-238

Sequence Info:Full length protein

View full details