Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Protein shisa-2 homolog(SHISA2)

Recombinant Bovine Protein shisa-2 homolog(SHISA2)

SKU:CSB-CF021267BO

Regular price ¥283,600 JPY
Regular price Sale price ¥283,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6QPA0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SGEYCHGWLDAQGVWRIGFQCPERFDGGDATICCGSCALRYCCSSADARLDQGGCDNDRQQGAGEPGRADKDGPDGSAVPIYVPFLIVGSVFVAFIVLGSLVAACCCRCLRPKQEPQLSRAPGGPRLVETIPMIPSASTSRGSSSRQSSTAASSSSSANSGARAPPTRSQTNCCLPEGTMNNVYVNMPTNFSVLNCQQATQIVPHQGQYLHPPFVGYTVQPDSVPLTPVPPFLDGLQTGYRQLQAPFPHTNSEQKMYPAVTV

Protein Names:Recommended name: Protein shisa-2 homolog Alternative name(s): Transmembrane protein 46

Gene Names:Name:SHISA2 Synonyms:TMEM46

Expression Region:28-289

Sequence Info:full length protein

View full details