Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Protein NKG7(NKG7)

Recombinant Bovine Protein NKG7(NKG7)

SKU:CSB-CF641617BO

Regular price ¥269,500 JPY
Regular price Sale price ¥269,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q2KJ11

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEPCRSLALLTSSLGLVSLLVAVSTNFWFAARGPGFSSHSGLWPSKDQVSVAGYIHVTQS FCILAVLWGLISTAFLVMSCIPSLSAPGRGPIVSTFMGFAGALSLIVAMTVYTIERWNQP ANPQVQSFFSWSFYLGWVSTLLFLCTGGLSLGAHCTTHRPDYEAV

Protein Names:Recommended name: Protein NKG7 Alternative name(s): Natural killer cell protein 7

Gene Names:Name:NKG7

Expression Region:1-165

Sequence Info:full length protein

View full details