Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(PIGL)

Recombinant Bovine N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase(PIGL)

SKU:CSB-CF017975BO

Regular price ¥281,800 JPY
Regular price Sale price ¥281,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6QQ24

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVAAPLLCLAAAVLVWGVLWVWGSWERMTRPEQAGLPGGGSRTLLVTAHPDDEAMFFAPTILGLARLRHQLFLLCFSAGNYYNQGEIRKKELLQSCDVLGIPPSNVMIIENRDFPDDPDVRWDPDRAADVLLQHVEANGIKLVVTFDEGGVSGHSNHVALNAAVRTLQAEGKLPKGCSVLTLQSVNLLRKYLCLLDLPCSLLLARDALFVLTQREAAQAQRAMSCHRSQLLWFRRLYMLFSRYMRINSLNFL

Protein Names:Recommended name: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase EC= 3.5.1.89 Alternative name(s): Phosphatidylinositol-glycan biosynthesis class L protein Short name= PIG-L

Gene Names:Name:PIGL

Expression Region:1-253

Sequence Info:full length protein

View full details