Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Mitochondrial brown fat uncoupling protein 1(UCP1)

Recombinant Bovine Mitochondrial brown fat uncoupling protein 1(UCP1)

SKU:CSB-CF025554BO

Regular price ¥293,200 JPY
Regular price Sale price ¥293,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P10861

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IFSAGVAACVADIITFPLDTAKVRLQIQGECLISSAIRYKGVLGTIITLAKTEGPVKLYS GLPAGLQRQISLASLRIGLYDTVQEFFTTGKEASLGSKISAGLMTGGVAVFIGQPTEVVK VRLQAQSHLHGPKPRYTGTYNAYRIIATTEGLTGLWKGTSPNLTTNVIINCTELVTYDLM KEALVKNKLLADDVPCHFVSAVVAGFCTTVLSSPVDVVKTRFVNSSPGQNTSVPNCAMMM LTREGPSAFFKGFVPSFLRLGSWNIMFVCFERLKQELMKCRHTMDCAT

Protein Names:Recommended name: Mitochondrial brown fat uncoupling protein 1 Short name= UCP 1 Alternative name(s): Solute carrier family 25 member 7 Thermogenin

Gene Names:Name:UCP1 Synonyms:SLC25A7, UCP

Expression Region:1-288

Sequence Info:Full length protein

View full details