Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Microsomal glutathione S-transferase 3(MGST3)

Recombinant Bovine Microsomal glutathione S-transferase 3(MGST3)

SKU:CSB-CF013793BO

Regular price ¥261,300 JPY
Regular price Sale price ¥261,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3T100

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPENGHIFNCIQRA HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKRQRGALSFI ALIGLMGTTVCSAFQHLGWVRTGLNSGCKSCH

Protein Names:Recommended name: Microsomal glutathione S-transferase 3 Short name= Microsomal GST-3 EC= 2.5.1.18

Gene Names:Name:MGST3

Expression Region:1-152

Sequence Info:full length protein

View full details