Recombinant Bovine Lutropin subunit beta(LHB)

Recombinant Bovine Lutropin subunit beta(LHB)

CSB-EP012910BO-GB
Regular price
¥126,000 JPY
Sale price
¥126,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P04651

Gene Names: LHB

Organism: Bos taurus (Bovine)

AA Sequence: SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL

Expression Region: 21-141aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 17 kDa

Alternative Name(s): Luteinizing hormone subunit beta ;LH-B ;LSH-B ;LSH-beta;Lutropin beta chain

Relevance: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Reference: The gene for the beta subunit of bovine luteinizing hormone encodes a gonadotropin mRNA with an unusually short 5'-untranslated region.Virgin J.B., Silver B.J., Thomason A.R., Nilson J.H.J. Biol. Chem. 260:7072-7077(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share