Gene Bio Systems
Recombinant Bovine Lutropin subunit beta(LHB)
Recombinant Bovine Lutropin subunit beta(LHB)
SKU:CSB-EP012910BO-GB
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P04651
Gene Names: LHB
Organism: Bos taurus (Bovine)
AA Sequence: SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL
Expression Region: 21-141aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 17 kDa
Alternative Name(s): Luteinizing hormone subunit beta ;LH-B ;LSH-B ;LSH-beta;Lutropin beta chain
Relevance: Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.
Reference: The gene for the beta subunit of bovine luteinizing hormone encodes a gonadotropin mRNA with an unusually short 5'-untranslated region.Virgin J.B., Silver B.J., Thomason A.R., Nilson J.H.J. Biol. Chem. 260:7072-7077(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
