Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Leukocyte surface antigen CD53(CD53)

Recombinant Bovine Leukocyte surface antigen CD53(CD53)

SKU:CSB-CF688356BO

Regular price ¥279,400 JPY
Regular price Sale price ¥279,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q58DM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGMSSLKLLKFVLFFFNLIFWFCGCCILGLGIYLLIHSKFGVLFHNLPSLTLGNVLVIVG SVIMVVAFLGCMGSIKENKCLLMSFFVLLLIILLAEVTLAILLFVYEQKLKEYVAEGLTE SIQRYNSDNSTKAAWDSIQSFLQCCGVNGTSDWTSGPPASCPKGSAVKGCYIQAKQWFHS NFLYIGITTICVCVIQVLGMSFALTLNCQIDKTSQVLGL

Protein Names:Recommended name: Leukocyte surface antigen CD53 Alternative name(s): Cell surface glycoprotein CD53 CD_antigen= CD53

Gene Names:Name:CD53

Expression Region:1-219

Sequence Info:full length protein

View full details