Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Leptin receptor gene-related protein(LEPROT)

Recombinant Bovine Leptin receptor gene-related protein(LEPROT)

SKU:CSB-CF668787BO

Regular price ¥263,500 JPY
Regular price Sale price ¥263,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3SYT0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRATYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVSVIKWGACGLVLAGNAVIFLTIQGFFLVF GRGDDFSWEQW

Protein Names:Recommended name: Leptin receptor gene-related protein Alternative name(s): OB-R gene-related protein Short name= OB-RGRP

Gene Names:Name:LEPROT Synonyms:LEPR, OBR

Expression Region:1-131

Sequence Info:full length protein

View full details