Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine L-selectin(SELL)

Recombinant Bovine L-selectin(SELL)

SKU:CSB-CF020977BO

Regular price ¥296,500 JPY
Regular price Sale price ¥296,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P98131

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:WTYHYSKRPMPWEKARAFCRENYTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEAKNWGAGEPNNRKSKEDCVEIYIKRNKDSGKWNDDACHKAKTALCYTASCKPWSCSGHGQCVEVINNYTCNCDLGYYGPECQFVTQCVPLEAPKLGTMACTHPLGNFSFMSQCAFNCSKGTDMIGVEETTCAPFGNWSSPEPTCRVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCSEEAELTGEKKTICGLSGNWSSPSPRCQKINRTISINEESDYNPLFIPVAVMVTAFSGLAFIIWLARRLKRKSKKVSEKHG

Protein Names:Recommended name: L-selectin Alternative name(s): CD62 antigen-like family member L Leukocyte adhesion molecule 1 Short name= LAM-1 Leukocyte-endothelial cell adhesion molecule 1 Short name= LECAM1 Lymph node homing receptor CD_antigen= CD62L

Gene Names:Name:SELL

Expression Region:39-370

Sequence Info:full length protein

View full details