Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Interferon tau-1(IFNT1)

Recombinant Bovine Interferon tau-1(IFNT1)

SKU:CSB-EP322795BO-GB

Regular price ¥190,400 JPY
Regular price Sale price ¥190,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P15696

Gene Names: IFNT1

Organism: Bos taurus (Bovine)

AA Sequence: CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

Expression Region: 24-195aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 23.8 kDa

Alternative Name(s): Antiluteolysin;Trophoblast antiluteolytic protein;Trophoblast protein 1 ;TP-1Trophoblastin

Relevance: Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.

Reference: Molecular cloning and characterization of complementary deoxyribonucleic acids corresponding to bovine trophoblast protein-1 a comparison with ovine trophoblast protein-1 and bovine interferon-alpha II.Imakawa K., Hansen T.R., Malathy P.-V., Anthony R.V., Polites H.G., Marotti K.R., Roberts R.M.Mol. Endocrinol. 3:127-139(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details