Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Inter-alpha-trypsin inhibitor heavy chain H2(ITIH2)

Recombinant Bovine Inter-alpha-trypsin inhibitor heavy chain H2(ITIH2)

SKU:CSB-EP011895BO

Regular price ¥147,800 JPY
Regular price Sale price ¥147,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cell Biology

Uniprot ID:P56651

Gene Names:ITIH2

Organism:Bos taurus (Bovine)

AA Sequence:LHYQEVKWRKLGSYEHRLHLKPGRLAKHELEVFNGYFVHFPAPENMIPIG

Expression Region:1-50aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 6xHis-KSI-tagged

MW:21.3 kDa

Alternative Name(s):/

Relevance:May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.

Reference:"A serum-derived hyaluronan-associated protein (SHAP) is the heavy chain of the inter alpha-trypsin inhibitor." Huang L., Yoneda M., Kimata K. J. Biol. Chem. 268:26725-26730(1993)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details