Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Fibronectin type III domain-containing protein 4(FNDC4)

Recombinant Bovine Fibronectin type III domain-containing protein 4(FNDC4)

SKU:CSB-CF008769BO

Regular price ¥270,100 JPY
Regular price Sale price ¥270,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6QPL2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV

Protein Names:Recommended name: Fibronectin type III domain-containing protein 4 Alternative name(s): Fibronectin type III repeat-containing protein 1

Gene Names:Name:FNDC4 Synonyms:FRCP1

Expression Region:41-230

Sequence Info:full length protein

View full details