Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine CKLF-like MARVEL transmembrane domain-containing protein 8(CMTM8)

Recombinant Bovine CKLF-like MARVEL transmembrane domain-containing protein 8(CMTM8)

SKU:CSB-CF630197BO

Regular price ¥264,900 JPY
Regular price Sale price ¥264,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q1RMP9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEEPQRARSQTVTTTASSFAENFSTTSSSFSYDREFLRTLPGLLIVAEIVLGLLVWTLIA GTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYLTMTYTRIPQVPWTTVGLWFNGSAFALYL SAAIVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ

Protein Names:Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 8 Alternative name(s): Chemokine-like factor superfamily member 8

Gene Names:Name:CMTM8 Synonyms:CKLFSF8

Expression Region:1-173

Sequence Info:full length protein

View full details