Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine B-cell receptor-associated protein 29(BCAP29)

Recombinant Bovine B-cell receptor-associated protein 29(BCAP29)

SKU:CSB-CF002591BO

Regular price ¥283,700 JPY
Regular price Sale price ¥283,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q32KL9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLQWTAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFSVWGKIASFWNKAFLTIIILLI VLFLDAVREVRKYSSTHTIEKSSASRPAAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKELSHKGVLKHQAENINQAAKKFMEENERLKRLLKNYGKEEEHILEAENKKL EEDKEKLKTELKKASDALSKAQNDVMIMKMQSERLSKEYDRLLREHSELQDRAGKDKKCL

Protein Names:Recommended name: B-cell receptor-associated protein 29 Short name= BCR-associated protein 29 Short name= Bap29

Gene Names:Name:BCAP29

Expression Region:1-240

Sequence Info:full length protein

View full details