Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Apolipoprotein A-I(APOA1),partial

Recombinant Bovine Apolipoprotein A-I(APOA1),partial

SKU:CSB-EP001913BO

Regular price ¥146,800 JPY
Regular price Sale price ¥146,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P15497

Gene Names:APOA1

Organism:Bos taurus (Bovine)

AA Sequence:DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ

Expression Region:25-265aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-B2M-tagged

MW:41.5

Alternative Name(s):Apolipoprotein A1 (Apo-AI) (ApoA-I)

Relevance:Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase. As part of the SPAP complex, activates spermatozoa motility.

Reference:"Carboxyl terminus of apolipoprotein A-I (ApoA-I) is necessary for the transport of lipid-free ApoA-I but not prelipidated ApoA-I particles through aortic endothelial cells." Ohnsorg P.M., Rohrer L., Perisa D., Kateifides A., Chroni A., Kardassis D., Zannis V.I., von Eckardstein A. J. Biol. Chem. 286:7744-7754(2011)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Apolipoprotein A1/A4/E family

Tissue Specificity:Major protein of plasma HDL, also found in chylomicrons.

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=49157

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:281631

STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000002914

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details