Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A(MGAT4A)

Recombinant Bovine Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A(MGAT4A)

SKU:CSB-CF013776BO

Regular price ¥333,500 JPY
Regular price Sale price ¥333,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:O77836

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLRNGTVATVLAFITSFLTLSWYTTWQNGKEKVIAYQREFLALKERLRIAEHRISQRSSELSAIVQQFKRVEAETNRSKDPVNKFSDDTLKILKELTSKKSLQVPSIYYHLPHLLQNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDTDYVNGVVANLEKEFSKEISSGLVEIISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGTYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLTGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPVAGDYILFKFDKPVNVESYLFHSGNQDHPGDILLNTTVEVLPLKSEGLDISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKVTN

Protein Names:Recommended name: Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A EC= 2.4.1.145 Alternative name(s): N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa Short name= GlcNAc-T IVa Short name= GnT-IVa Short name= N-acetylglucosaminyltransferase IVa UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa Cleaved into the following chain: 1. Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form

Gene Names:Name:MGAT4A

Expression Region:1-535

Sequence Info:full length protein

View full details